PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_4704g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 496aa    MW: 55293.3 Da    PI: 7.1792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_4704g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-16128173147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v q+G+ +W++Ia+++  gR++k+c++rw++ 
     MA_4704g0010 128 RGHWRPAEDAKLKELVSQYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 173
                      899*****************************.***********996 PP

2Myb_DNA-binding52.89.1e-17180223146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++e++e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
     MA_4704g0010 180 RRPFSEEDEEKLLAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 223
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.14123174IPR017930Myb domain
SMARTSM007171.9E-14127176IPR001005SANT/Myb domain
PfamPF002491.0E-15128173IPR001005SANT/Myb domain
SuperFamilySSF466895.24E-28128221IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-26129181IPR009057Homeodomain-like
CDDcd001674.44E-13131172No hitNo description
PROSITE profilePS5129425.682175229IPR017930Myb domain
SMARTSM007174.4E-15179227IPR001005SANT/Myb domain
PfamPF002491.8E-13180222IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-20182228IPR009057Homeodomain-like
CDDcd001677.39E-12182222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MCHTQKDGPS RNWIRPENRL NNPMMQNTRI SAESRQFLVV GSSGFMQPGV ESESGNEEAM  60
LMNNTTTNAT AVTPCDPKSW TIQMGSMESS SGHHSAKVSS DNNMGNLGDS NEEVENSVDG  120
VQSRLCARGH WRPAEDAKLK ELVSQYGPQN WNLIAEKLEG RSGKSCRLRW FNQLDPRINR  180
RPFSEEDEEK LLAAHRLYGN KWAMIARLFP GRTDNAVKNH WHVIMARRYR EQSSAFGRRK  240
LTQVHRREKR VCTEDETGTA SSNMWVDKFS SFKSSHDVIL RRGSVCKSQI PGENASCVSV  300
FGAPRVDDDE RCGNFDRLQQ RIGAASIAPP HHHQQRSYIS SLDAVQSRIF FEGSREMKIN  360
NNYNKAVDML GSNVDNYHIL VSQMEGESSS PSQLTTDSCA AVSLLQGAFA SSKRSSVVNT  420
NFSLGHQQNV VQYGYSDSSA SDQLSAVEAS YADNSSTTGN NNYLMATRSL VFEEEAEIEF  480
KKPNGGFIDF LGVGTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-311282287107B-MYB
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1109030.0BT110903.1 Picea glauca clone GQ03229_J07 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.11e-70myb domain protein 117